PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00129.1.g00840.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 1620aa    MW: 176041 Da    PI: 6.4136
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00129.1.g00840.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.53.5e-09794836347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +WT+eE e++ +  +++G++ +++I++ +  ++t  +c+++++k+
  Zjn_sc00129.1.g00840.1.sm.mkhc 794 PWTQEEKEIFMETLAKFGKD-FSKISSFIT-HKTTADCVEFYYKH 836
                                     8*****************99.********9.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.8E-15778839IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-7785839IPR009057Homeodomain-like
PROSITE profilePS5129315.886790841IPR017884SANT domain
SMARTSM007171.8E-8791839IPR001005SANT/Myb domain
PfamPF002492.8E-7793836IPR001005SANT/Myb domain
PROSITE profilePS5129312.6669981049IPR017884SANT domain
SMARTSM007171.3E-69991047IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-410021044IPR009057Homeodomain-like
SuperFamilySSF466893.98E-910021049IPR009057Homeodomain-like
CDDcd001676.29E-510031041No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1620 aa     Download sequence    Send to blast
MPPPPPPDRR DFLYRDGRRH DGGGGGDPLP PPAPTPPRWR DSPYHAPPPP PMRDHARPSP  60
RRAPSSVSIG TPAPRKSSDL RPLPPPPPSP APLISPNPSA VSESYYRQGG GAYDRPYPDE  120
MPLGYTPSRS DRYWMDDEGG GYKGFSRYGG GRRDGRDMRG SYRRSPFRSY GNDFSRNHQE  180
QPPPPPPRRS PLRSVALPIY DPPGNRVDRG DRDSLPRVTP WRRRENRSEA AGAAGAGHVS  240
AGQSALLAAS GNEVSAHPPA VTSPHGAEEA PRKKARLGWG QGLAKYEKQK VQGPTDPSED  300
VALGSPAESS FSCTCSCAMH IDDCCATIST SAMCIPSCGA ATSTSTMRIP GFCTITSIYG  360
MCISGFCSGT CTSRMYISSS STITSICGTT CTSTMCICDT TCTCTSMCIS APEVKSCDLT  420
ANTVLNSTQD TPGADDQACN NEFPIKIDQL GDDRIDSLAT LLAKFLEHDS CHGDSKDPSS  480
TSKLLLLKES ISKEIEKTEL EIDSLEGELK SVNTVAPEDS PTGVTYTENI SPPSGTSKVP  540
GCDKSHVKEP RELSPFPKIP IVQDANVKDA ENMDIETAPV HNAKTASEES AACPENQAQA  600
AADVGPVNVS GGAGPQIDVD NERLEVSSCH IDTDSVKADG GVDLRGRQCL YPNHDLLSSV  660
TSSNHDIAKE ANESVFKCLS GDTPRLDLLD TSHVSIERKN VSFIKEKLML RKSRLSFKEQ  720
ALTFKFRVLL SALIKPAGHH ILDLRDNVKR RRNYFKMPAL IINEKEKECS RFLSKNGLIE  780
DPVAVEKERV MINPWTQEEK EIFMETLAKF GKDFSKISSF ITHKTTADCV EFYYKHHKSD  840
SFREVKKLLD QHQQQQPTST FLGAKSGKKW NREANAASLD ILGIASAVAA QGLEYEKRVE  900
KFSAKSLIRN VSNVSFVARK SSRECFDNTS LHERESVAAD VLAGICGTLS PEGMSSCITS  960
SADPGQKINI TRMENALTLE IGKNVDDEDT LSDIECEVDP VDWNDDEKQI FIEAMNNYGK  1020
DFARISSCVK SKSYEQCKVF FSKARKSLGL DLIHQGAADI NMPTSDTNGG RSDTDEACAA  1080
EMDSAICSTQ SFAKTEMDVC PTERAVQGPS SCVISKQTEG DGSNDCNVLD VNTECENKAD  1140
KTCDDQKRFN EVAHQSQCGP IDINCPETTE KLEVTADTVD QMNMHNSSAV ISSKDQPEAR  1200
MDGCSHPALD NALVKAGTAD PSASMVAESG IKENIHHFSN PPSTSSYQHS VPRDKPPSKP  1260
KPQVTPLTPK DLMPVQFSSV LPDPTSIRFE GIASITTPNF EDTGNRACNA LEAKDMNKYP  1320
AFKEQSQAGQ HDLLFHNIDG YKKHLATEAS IFSERNTCGT VSTSQSDRFT VTKFQNGRSN  1380
SLGGLPNTKG IHWDREHNEV SDGSLRHCSH NTSSDSNEQI KRLGDVKLFG QILSHQSSQN  1440
SGSSCNGSKN KPSLPNVDTS SMRLLNSPRD HVSCSPRPVA TGHLGLDNRS VRTYGHLDGS  1500
TTQPEPLPTM AKCQTSLSGV PFYSAKNGTR GMFSGYQQPL MQAHQSDPKL LERYSDPHKR  1560
NGMEFISGFQ QQPGKVSLFG GAGVLVSGVS DPVAALKAQY GPGSKITSCD VDPWKDIGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D3e-14757843994NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C3e-14757843994NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960366.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_012700232.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_004960367.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
TrEMBLK3Z3350.0K3Z335_SETIT; Uncharacterized protein
STRINGSi020953m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.17e-69MYB family protein